Tesamorelin

£54.50

Purity: ≥99% (HPLC)
Batch-controlled manufacturing
Secure packaging for laboratory handling
Storage: Store lyophilised powder frozen for long-term stability.
Following preparation in accordance with laboratory protocols, store solutions refrigerated (2– 8 °C).
Research use only (not for human or veterinary use)

Milligrams

10mg

Free UK delivery on orders over £30

Same-day dispatch order before 2pm

Certificate of Analysis View

Discreet packaging 100% private

Bacteriostatic water 10ml (+£6.50)

Key Specifications

Purity: ≥99% (HPLC)
Batch-controlled manufacturing
Secure packaging for laboratory handling
Storage: Store lyophilised powder frozen for long-term stability.
Following preparation in accordance with laboratory protocols, store solutions refrigerated (2– 8 °C).
Research use only (not for human or veterinary use)

Description

Tesamorelin is a synthetic peptide supplied as a lyophilised powder for controlled laboratory research investigations. In scientific literature, this compound is referenced in experimental studies examining peptide–receptor interaction behaviour and associated intracellular signalling pathways within defined laboratory models. Tesamorelin has been referenced in controlled in-vitro and experimental laboratory studies investigating peptide-mediated signalling behaviour under structured research conditions.

Research context

In controlled laboratory research environments, Tesamorelin has been examined in experimental studies investigating peptide signalling and receptor-interaction dynamics. Documented laboratory investigations include:

Evaluation of peptide–receptor interaction behaviour in cell-based assay systems
Measurement of downstream intracellular signalling markers in defined experimental models
Observation of molecular response patterns within controlled research environments

These references describe laboratory research environments only and do not imply clinical, therapeutic, or human application.

Technical Data

Chemical name: Tesamorelin (GHRH/GRF analogue; N-terminally modified) Synonyms: Tesamorelin; TH9507; (3E)-hex-3-enoyl GHRH (1–44) Peptide length: 44 amino acids Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular formula: C221H366N72O67S Molecular weight: ~5136 g/mol CAS: 218949-48-5 (tesamorelin; acetate salt may be listed separately) Form: Lyophilised (freeze-dried) powder Appearance: White to off-white solid

Legal & Safety

This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use and is not marketed for the diagnosis, treatment, cure, mitigation, or prevention of any disease or medical condition. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.

Reviews (0)