Tesamorelin

£34.50

Quantity Price Discount
2 £32.78 5%
3-4 £31.05 10%
5+ £29.33 15%
  • Purity: ≥99% (HPLC)
  •  Batch-controlled manufacturing
  •  Secure packaging for laboratory handling
  •  Storage: Store lyophilised powder frozen for long-term stability.
  •  Following preparation in accordance with laboratory protocols, store solutions refrigerated (2–   8 °C).
  •  Research use only (not for human or veterinary use)
Free UK delivery unlocked!
Free UK delivery on orders over £30
Same-day dispatch order before 2pm
Certificate of Analysis View
Discreet packaging 100% private

International orders? Contact us on WhatsApp.

Bacteriostatic water
Bacteriostatic water 10ml (+£7.50)
Key Specifications
  • Purity: ≥99% (HPLC)
  •  Batch-controlled manufacturing
  •  Secure packaging for laboratory handling
  •  Storage: Store lyophilised powder frozen for long-term stability.
  •  Following preparation in accordance with laboratory protocols, store solutions refrigerated (2–   8 °C).
  •  Research use only (not for human or veterinary use)
Description

The body’s endocrine system relies on highly coordinated communication between the brain and hormone-producing glands to maintain physiological balance. Tesamorelin has become a recognised laboratory research peptide within this field, appearing in studies exploring Growth Hormone-Releasing Hormone (GHRH) biology, hypothalamic-pituitary signalling and endocrine regulation.

As researchers continue to investigate the molecular pathways that coordinate hormonal communication, Tesamorelin remains an important subject of laboratory research across multiple areas of endocrinology and neuroendocrine science.

For a fuller overview of the research background to this compound, see our What Is Tesamorelin? guide.

Key Research Areas

  • Growth Hormone-Releasing Hormone (GHRH) biology
  • Hypothalamic-pituitary signalling
  • Endocrine regulation
  • Receptor-mediated signalling

Tesamorelin is a synthetic analogue of Growth Hormone-Releasing Hormone (GHRH) and has attracted sustained scientific interest because of its well-characterised interaction with endocrine signalling pathways. Its defined structure and receptor specificity have made it a valuable research peptide for laboratory investigations examining hormone regulation and neuroendocrine communication.

Rather than being investigated within a single biological pathway, Tesamorelin has featured in experimental studies exploring receptor biology, intracellular signalling and hormonal communication. This focused scientific profile has established it as a recognised laboratory research peptide within experimental endocrinology.

One of the principal reasons Tesamorelin remains an important subject of scientific investigation is its association with Growth Hormone-Releasing Hormone (GHRH) biology. GHRH is produced within the hypothalamus and plays a central role in regulating communication with the pituitary gland through precisely controlled receptor interactions.

Understanding these signalling pathways continues to be a major objective of endocrine research. Experimental studies involving Tesamorelin have therefore explored the molecular mechanisms associated with receptor activation and downstream cellular signalling.

Closely connected to this work is the study of hypothalamic-pituitary signalling. The hypothalamus and pituitary function as an integrated biological system, coordinating hormonal communication through complex feedback mechanisms that help maintain physiological balance.

Researchers continue to investigate these regulatory networks, with Tesamorelin appearing in laboratory studies examining endocrine communication and molecular signalling.

Scientific interest in Tesamorelin also extends to endocrine regulation. Hormonal signalling depends upon tightly controlled communication between receptors, signalling molecules and endocrine tissues.

Understanding these interactions remains an important focus of laboratory research, with Tesamorelin continuing to feature in experimental studies exploring neuroendocrine physiology and receptor-mediated communication.

What distinguishes Tesamorelin from many other laboratory research peptides is its close association with the natural biology of GHRH signalling. Rather than spanning numerous unrelated biological systems, it provides researchers with a focused model for investigating endocrine communication, receptor biology and hypothalamic-pituitary physiology.

This focused scientific profile continues to make Tesamorelin a recognised laboratory research peptide for scientists seeking to better understand the molecular mechanisms that regulate endocrine function.

This overview introduces Tesamorelin as a laboratory research peptide and highlights the scientific areas in which it continues to be investigated.

Technical Data

Chemical name: Tesamorelin (GHRH/GRF analogue; N-terminally modified)

Synonyms: Tesamorelin; TH9507; (3E)-hex-3-enoyl GHRH (1–44)

Peptide length: 44 amino acids

Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular formula: C221H366N72O67S

Molecular weight: ~5136 g/mol

CAS: 218949-48-5 (tesamorelin; acetate salt may be listed separately)

Form: Lyophilised (freeze-dried) powder

Appearance: White to off-white solid

For storage and handling of this material, see our guide on how to store peptides.

This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use and is not marketed for the diagnosis, treatment, cure, mitigation, or prevention of any disease or medical condition. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.

Certificate of Analysis

Certificate of Analysis for Tesamorelin — verifying purity, identity, and quality.

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin”

Your email address will not be published. Required fields are marked *

Reviews are checked before they appear. Please write about your own genuine experience of the product, and note that we cannot publish reviews describing use in humans or animals, dosing, or health effects. Our review rules.

Related Products