Tesamorelin 10mg

£49.50

  • Purity: ≥99% (HPLC)
  • Batch-controlled manufacturing
  • Secure packaging for laboratory handling
  • Storage: store the lyophilised powder frozen for long-term stability. After reconstitution, keep the solution refrigerated (2–8°C).
  • Research use only (not for human or veterinary use)

Bacteriostatic Water Available

Tesamorelin is a synthetic research peptide supplied as a lyophilised powder. It is commonly described as a modified form of human GHRH (growth hormone–releasing hormone) with an added fatty-acid group designed to improve stability, and is used in controlled experimental settings to study growth-hormone pathway signalling and related downstream markers in preclinical models.

Preclinical Focus (research Context)

In laboratory and animal studies, tesamorelin is most commonly explored for growth-hormone pathway and metabolism-related research. Researchers use it in controlled models to observe things like:

  • Markers showing growth-hormone pathway activation (a common “pathway confirmation” readout)
  • Downstream growth-factor signalling markers that are often tracked alongside GH pathway studies (study-dependent)
  • Metabolism-related lab markers sometimes measured alongside GH/IGF signalling (model-dependent)
  • Body-composition and metabolic measurements reported in preclinical study designs, depending on the model and protocol

These are preclinical observations and results can vary by model and study design.

Technical Data

  • Chemical name: Tesamorelin (GHRH/GRF analogue; N-terminally modified)
  • Synonyms: Tesamorelin; TH9507; (3E)-hex-3-enoyl GHRH (1–44) (commonly referenced)
  • Peptide length: 44 amino acids (GHRH (1–44) analogue with an added trans-3-hexenoyl group)
  • Active sequence (44 aa): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular formula: C221H366N72O67S
  • Molecular weight: ~5136 g/mol
  • CAS: 218949-48-5 (tesamorelin); acetate salt is often listed separately (see COA if applicable)
  • Form: Lyophilised (freeze-dried) powder
  • Appearance: White to off-white solid

Legal & Safety

This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use, and it is not marketed for diagnosis, treatment, or prevention of any disease. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin 10mg”

Your email address will not be published. Required fields are marked *