CJC-1295 without DAC
£23.50
| Quantity | Price | Discount |
|---|---|---|
| 2 | £18.53 | 5% |
| 3-9 | £17.55 | 10% |
| 10+ | £16.58 | 15% |
- Purity: ≥99% (HPLC)
- Batch-controlled manufacturing
- Secure packaging for laboratory handling
- Storage: Store lyophilised powder frozen for long-term stability.
- Following preparation in accordance with laboratory protocols, store solutions refrigerated (2– 8 °C).
- Research use only (not for human or veterinary use)
Get notified when it's back in stock
- Purity: ≥99% (HPLC)
- Batch-controlled manufacturing
- Secure packaging for laboratory handling
- Storage: Store lyophilised powder frozen for long-term stability.
- Following preparation in accordance with laboratory protocols, store solutions refrigerated (2– 8 °C).
- Research use only (not for human or veterinary use)
The endocrine system regulates the body’s hormones through remarkably precise biological rhythms. CJC-1295 (No DAC) has become a recognised laboratory research peptide within this field, appearing in studies exploring growth hormone signalling, receptor biology and pituitary physiology.
As researchers continue to investigate the molecular pathways that regulate endocrine communication, CJC-1295 (No DAC) remains an important subject of laboratory research across multiple areas of neuroendocrinology.
Key Research Areas
- Growth hormone signalling
- Growth Hormone-Releasing Hormone (GHRH) receptor biology
- Pituitary physiology
- Neuroendocrine regulation
Developed as a synthetic analogue of Growth Hormone-Releasing Hormone (GHRH), CJC-1295 (No DAC) has attracted sustained scientific interest because of its well-defined interaction with the GHRH receptor.
Unlike the DAC-modified version, CJC-1295 (No DAC) was designed without a Drug Affinity Complex, making it particularly relevant for laboratory studies investigating pulsatile hormone signalling and receptor activation. Its distinct pharmacological profile has established it as a recognised research peptide within experimental endocrinology.
One of the principal reasons CJC-1295 (No DAC) remains an important subject of scientific investigation is its association with growth hormone signalling. Growth hormone release is regulated through a complex network of hormonal feedback loops that help maintain physiological balance and coordinate normal biological function.
Understanding these signalling pathways continues to be a major objective of endocrine research. Experimental studies involving CJC-1295 (No DAC) have therefore explored the molecular mechanisms responsible for receptor activation and downstream cellular signalling.
Closely connected to this work is the study of pituitary physiology. The pituitary gland plays a central role in coordinating endocrine communication by responding to signals from the hypothalamus and regulating the release of multiple hormones.
Researchers continue to investigate how these communication networks operate under normal physiological conditions, with CJC-1295 (No DAC) appearing in laboratory studies examining receptor biology and hormone regulation.
Scientific interest in CJC-1295 (No DAC) also extends to neuroendocrine regulation. The endocrine and nervous systems function through closely integrated signalling pathways that coordinate hormonal release in response to changing physiological demands.
Understanding these interactions remains an important area of laboratory research, with CJC-1295 (No DAC) continuing to feature in experimental studies exploring endocrine communication and receptor-mediated signalling.
What distinguishes CJC-1295 (No DAC) from many other research peptides is its close association with the natural biology of GHRH signalling. Rather than being investigated across unrelated biological systems, it provides researchers with a well-characterised model for studying hormone regulation, receptor activation and neuroendocrine communication.
This focused scientific profile continues to make CJC-1295 (No DAC) a recognised laboratory research peptide within contemporary endocrine research.
This overview introduces CJC-1295 (No DAC) as a laboratory research peptide and highlights the scientific areas in which it continues to be investigated.
For researchers wishing to explore the published literature, biological pathways and experimental evidence in greater depth, our dedicated CJC-1295 (No DAC) Research Guide provides a comprehensive overview of the peptide and its role within contemporary endocrine and neuroendocrine research.
Chemical name: CJC-1295 (No DAC) (Modified GRF (1–29) / GHRH (1–29) analogue)
Synonyms: Mod GRF (1–29); Modified GRF (1–29); CJC-1295 (No DAC)
Peptide length: 29 amino acids
Sequence (1-letter): Y(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH₂
Sequence (3-letter): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂
Molecular formula: C152H252N44O42
Molecular weight: ~3367.9 g/mol
CAS: See COA (CAS numbers may vary across listings)
Form: Lyophilised (freeze-dried) powder
Appearance: White to off-white solid
For storage and handling of this material, see our guide on how to store peptides.
This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use and is not marketed for the diagnosis, treatment, cure, mitigation, or prevention of any disease or medical condition. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.
Certificate of Analysis for CJC-1295 without DAC — verifying purity, identity, and quality.

Reviews
There are no reviews yet.