CJC-1295 without DAC
£37.50
- Purity: ≥99% (HPLC)
- Batch-controlled manufacturing
- Secure packaging for laboratory handling
- Storage: Store lyophilised powder frozen for long-term stability.
- Following preparation in accordance with laboratory protocols, store solutions refrigerated (2– 8 °C).
- Research use only (not for human or veterinary use)
Free UK delivery
on orders over £30
Same-day dispatch
order before 2pm
Certificate of Analysis
View
Discreet packaging
100% private
Key Specifications
- Purity: ≥99% (HPLC)
- Batch-controlled manufacturing
- Secure packaging for laboratory handling
- Storage: Store lyophilised powder frozen for long-term stability.
- Following preparation in accordance with laboratory protocols, store solutions refrigerated (2– 8 °C).
- Research use only (not for human or veterinary use)
Description
CJC-1295 (No DAC) is a synthetic peptide supplied as a lyophilised powder for controlled laboratory research investigations. In scientific literature, this compound is referenced in experimental studies examining peptide–receptor interaction behaviour and associated intracellular signalling pathways within defined laboratory models.
CJC-1295 (No DAC) has been referenced in controlled in-vitro and experimental laboratory studies investigating peptide signalling behaviour under structured research conditions.
Research context
In controlled laboratory research environments, CJC-1295 (No DAC) has been examined in experimental studies investigating peptide signalling and receptor-interaction dynamics. Documented laboratory investigations include:- Evaluation of receptor-binding interaction behaviour in cell-based assay systems
- Measurement of downstream intracellular signalling markers in defined experimental models
- Observation of molecular response patterns within controlled research environments
Technical Data
Chemical name: CJC-1295 (No DAC) (Modified GRF (1–29) / GHRH (1–29) analogue)
Synonyms: Mod GRF (1–29); Modified GRF (1–29); CJC-1295 (No DAC)
Peptide length: 29 amino acids
Sequence (1-letter): Y(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH₂
Sequence (3-letter): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂
Molecular formula: C152H252N44O42
Molecular weight: ~3367.9 g/mol
CAS: See COA (CAS numbers may vary across listings)
Form: Lyophilised (freeze-dried) powder
Appearance: White to off-white solid
Legal & Safety
This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use and is not marketed for the diagnosis, treatment, cure, mitigation, or prevention of any disease or medical condition. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.
Reviews (0)
Be the first to review “CJC-1295 without DAC” Cancel reply
Related Products
5-Amino-1MQ
£64.50
50mg
Add to basket
This product has multiple variants. The options may be chosen on the product page
Bacteriostatic Water
£7.50
10ml
Add to basket
This product has multiple variants. The options may be chosen on the product page
IGF-1 LR3
£34.50
1mg
Add to basket
This product has multiple variants. The options may be chosen on the product page
SS-31
£27.50
10mg
50mg
Add to basket
This product has multiple variants. The options may be chosen on the product page
Tesamorelin
£54.50
10mg
Add to basket
This product has multiple variants. The options may be chosen on the product page

Reviews
There are no reviews yet.