CJC-1295 without DAC

£23.50

Quantity Price Discount
2 £22.33 5%
3-9 £21.15 10%
10+ £19.98 15%
  •  Purity: ≥99% (HPLC)
  •  Batch-controlled manufacturing
  •  Secure packaging for laboratory handling
  •  Storage: Store lyophilised powder frozen for long-term stability.
  •  Following preparation in accordance with laboratory protocols, store solutions refrigerated (2–   8 °C).
  •  Research use only (not for human or veterinary use)
Add £30.00 more for free UK delivery
Free UK delivery on orders over £30
Same-day dispatch order before 2pm
Certificate of Analysis View
Discreet packaging 100% private
Bacteriostatic water
Bacteriostatic water 10ml (+£7.50)
Key Specifications
  •  Purity: ≥99% (HPLC)
  •  Batch-controlled manufacturing
  •  Secure packaging for laboratory handling
  •  Storage: Store lyophilised powder frozen for long-term stability.
  •  Following preparation in accordance with laboratory protocols, store solutions refrigerated (2–   8 °C).
  •  Research use only (not for human or veterinary use)
Description

The endocrine system regulates the body’s hormones through remarkably precise biological rhythms. CJC-1295 (No DAC) has become a recognised laboratory research peptide within this field, appearing in studies exploring growth hormone signalling, receptor biology and pituitary physiology.

As researchers continue to investigate the molecular pathways that regulate endocrine communication, CJC-1295 (No DAC) remains an important subject of laboratory research across multiple areas of neuroendocrinology.

Key Research Areas

  • Growth hormone signalling
  • Growth Hormone-Releasing Hormone (GHRH) receptor biology
  • Pituitary physiology
  • Neuroendocrine regulation

Developed as a synthetic analogue of Growth Hormone-Releasing Hormone (GHRH), CJC-1295 (No DAC) has attracted sustained scientific interest because of its well-defined interaction with the GHRH receptor.

Unlike the DAC-modified version, CJC-1295 (No DAC) was designed without a Drug Affinity Complex, making it particularly relevant for laboratory studies investigating pulsatile hormone signalling and receptor activation. Its distinct pharmacological profile has established it as a recognised research peptide within experimental endocrinology.

One of the principal reasons CJC-1295 (No DAC) remains an important subject of scientific investigation is its association with growth hormone signalling. Growth hormone release is regulated through a complex network of hormonal feedback loops that help maintain physiological balance and coordinate normal biological function.

Understanding these signalling pathways continues to be a major objective of endocrine research. Experimental studies involving CJC-1295 (No DAC) have therefore explored the molecular mechanisms responsible for receptor activation and downstream cellular signalling.

Closely connected to this work is the study of pituitary physiology. The pituitary gland plays a central role in coordinating endocrine communication by responding to signals from the hypothalamus and regulating the release of multiple hormones.

Researchers continue to investigate how these communication networks operate under normal physiological conditions, with CJC-1295 (No DAC) appearing in laboratory studies examining receptor biology and hormone regulation.

Scientific interest in CJC-1295 (No DAC) also extends to neuroendocrine regulation. The endocrine and nervous systems function through closely integrated signalling pathways that coordinate hormonal release in response to changing physiological demands.

Understanding these interactions remains an important area of laboratory research, with CJC-1295 (No DAC) continuing to feature in experimental studies exploring endocrine communication and receptor-mediated signalling.

What distinguishes CJC-1295 (No DAC) from many other research peptides is its close association with the natural biology of GHRH signalling. Rather than being investigated across unrelated biological systems, it provides researchers with a well-characterised model for studying hormone regulation, receptor activation and neuroendocrine communication.

This focused scientific profile continues to make CJC-1295 (No DAC) a recognised laboratory research peptide within contemporary endocrine research.

This overview introduces CJC-1295 (No DAC) as a laboratory research peptide and highlights the scientific areas in which it continues to be investigated.

For researchers wishing to explore the published literature, biological pathways and experimental evidence in greater depth, our dedicated CJC-1295 (No DAC) Research Guide provides a comprehensive overview of the peptide and its role within contemporary endocrine and neuroendocrine research.

Technical Data

Chemical name: CJC-1295 (No DAC) (Modified GRF (1–29) / GHRH (1–29) analogue)

Synonyms: Mod GRF (1–29); Modified GRF (1–29); CJC-1295 (No DAC)

Peptide length: 29 amino acids

Sequence (1-letter): Y(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH₂

Sequence (3-letter): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂

Molecular formula: C152H252N44O42

Molecular weight: ~3367.9 g/mol

CAS: See COA (CAS numbers may vary across listings)

Form: Lyophilised (freeze-dried) powder

Appearance: White to off-white solid

For storage and handling of this material, see our guide on how to store peptides.

This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use and is not marketed for the diagnosis, treatment, cure, mitigation, or prevention of any disease or medical condition. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.

 

Certificate of Analysis

Certificate of Analysis for CJC-1295 without DAC — verifying purity, identity, and quality.

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “CJC-1295 without DAC”

Your email address will not be published. Required fields are marked *

Reviews are checked before they appear. Please write about your own genuine experience of the product, and note that we cannot publish reviews describing use in humans or animals, dosing, or health effects. Our review rules.

Related Products