CJC-1295 without DAC 10mg

£18.50

  • Purity: ≥99% (HPLC)
  • Batch-controlled manufacturing
  • Secure packaging for laboratory handling
  • Storage: store the lyophilised powder frozen for long-term stability. After reconstitution, keep the solution refrigerated (2–8°C).
  • Research use only (not for human or veterinary use)

Bacteriostatic Water Available

CJC-1295 without DAC is a synthetic research peptide commonly described as a modified fragment of GHRH (growth hormone–releasing hormone). In preclinical research settings, it is typically used to study growth-hormone signalling and downstream pathways in controlled experimental models.

Preclinical Focus (Research Context)

In laboratory and animal studies, CJC-1295 without DAC is most commonly explored for growth-hormone pathway research. Researchers use it in controlled models to observe things like:

  • Markers of growth-hormone signalling in lab settings (a common “pathway activity” readout)
  • Downstream growth-factor related measurements tracked in research models (study-dependent)
  • Metabolism-related signals that are sometimes measured alongside growth-hormone pathway studies (model-dependent)
  • Comparison of response patterns in short-acting / pulsatile-style experimental designs (depending on protocol)

These are preclinical observations and results can vary by model and study design.

Technical Data

  • Chemical name: CJC-1295 without DAC (Modified GRF (1–29) / GHRH (1–29) analogue)
  • Synonyms: Mod GRF (1–29); Modified GRF (1–29); CJC-1295 (No DAC)
  • Peptide length: 29 amino acids
  • Sequence (3-letter): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Sequence (1-letter): Y(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
  • Molecular formula: C152H252N44O42
  • Molecular weight: ~3367.9 g/mol
  • CAS: See COA (CAS numbers vary across supplier listings)
  • Form: Lyophilised (freeze-dried) powder
  • Appearance: White to off-white solid

Legal & Safety

This product is supplied strictly for laboratory research purposes. It is not intended for human consumption or veterinary use, and it is not marketed for diagnosis, treatment, or prevention of any disease. No directions for personal use are provided or implied. The purchaser is responsible for ensuring compliant handling, storage, and use in accordance with applicable laws and regulations.

 

Reviews

There are no reviews yet.

Be the first to review “CJC-1295 without DAC 10mg”

Your email address will not be published. Required fields are marked *